PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_25229_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 300aa    MW: 32808.1 Da    PI: 8.5326
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_25229_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.14.9e-15105144242
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++k+CnCk+s+Clk+YCeCfa+g +C+  C+C +C+N+ e+
  Neem_25229_f_1 105 KQKQCNCKHSRCLKLYCECFASGIYCDG-CNCVNCHNNVEN 144
                     89**************************.********9875 PP

2TCR52.21.2e-16189228140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Neem_25229_f_1 189 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 228
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-17104144IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.605105229IPR005172CRC domain
PfamPF036384.8E-12106141IPR005172CRC domain
SMARTSM011148.4E-20189230IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.7E-13192227IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGEGEGGEFP PRKAQSESSG EYPAKKLARQ LDFTGSFVSN VVLPEHPQSL AMPANTQSQP  60
QLKSVVPPVP PPPAATQPPV RVPKPESPKS RSRPNIEVKD STPKKQKQCN CKHSRCLKLY  120
CECFASGIYC DGCNCVNCHN NVENEAARRE AVEATLERNP NAFRPKIASS PHGTRDNREE  180
TGEFLMLGKH NKGCHCKKSG CLKKYCECFQ ANILCSENCK CMDCKNFEGS EERQALFHGD  240
HANNMAYIQQ AANAAITGAI GSSGYASPPV SKKRKGQELF FGSTAKDPSI QRHGHFPQAS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451190.10.0hypothetical protein CICLE_v10007795mg
RefseqXP_006475649.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-137TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV4UJK80.0V4UJK8_9R
STRINGPOPTR_0006s16340.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-107Tesmin/TSO1-like CXC domain-containing protein